PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G148100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 263aa    MW: 27979.7 Da    PI: 8.5719
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G148100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEde+lv +++ +G g+W++ ++  g+ R++k+c++rw +yl
  Sobic.009G148100.1.p 14 KGAWTKEEDERLVAYIRAHGEGCWRSLPKAAGLPRCGKSCRLRWMNYL 61
                          79******************************99************97 PP

2Myb_DNA-binding55.61.2e-1767111147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg++T +Edel+++++ +lG++ W++Ia  ++ gRt++++k++w+++
  Sobic.009G148100.1.p  67 RGNFTDDEDELIIRLHSLLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 111
                           89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129418.224961IPR017930Myb domain
SuperFamilySSF466891.39E-2913108IPR009057Homeodomain-like
SMARTSM007173.9E-141363IPR001005SANT/Myb domain
PfamPF002496.3E-151461IPR001005SANT/Myb domain
CDDcd001676.16E-111661No hitNo description
PROSITE profilePS5129428.162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.8E-2865116IPR009057Homeodomain-like
SMARTSM007171.4E-1666114IPR001005SANT/Myb domain
PfamPF002491.0E-1567111IPR001005SANT/Myb domain
CDDcd001677.40E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDERLVAYIR AHGEGCWRSL PKAAGLPRCG KSCRLRWMNY  60
LRPDLKRGNF TDDEDELIIR LHSLLGNKWS LIAGQLPGRT DNEIKNYWNT HIKRKLLARG  120
IDPQTHRALG VRADAATAPG AVAAHHRAAA LLHHHAGAVV VPVAPVKLLA VKPAPAESSS  180
DDGGSSSTGS SGGGSAGEPR CPDLNLNLDL SVGSPPPAAA ADTPTSLCLC YRLGLRAGEA  240
CGCEADITGQ QGFRFFRPLE QG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29141167108B-MYB
1h8a_C6e-291311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.80661e-126leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF3725210.0EF372521.1 Saccharum officinarum MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638107.11e-120PREDICTED: myb-related protein 308
SwissprotP813936e-92MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A096R5S11e-122A0A096R5S1_MAIZE; Uncharacterized protein
STRINGGRMZM2G077789_P011e-121(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.12e-85myb domain protein 6